distributer Urdu Meaning

Distributer - Urdu Meaning and Translation of Distributer (مہیا کرنے والا - muhayya karnay wala), Total 2 meanings for Distributer , Roman Urdu Meaning for word Distributer , English Definition and more.

Urdu Meanings

iJunoon official Urdu Dictionary

مہیا کرنے والا

muhayya karnay wala

تقسیم کرنے والا

taqseem karnay wala

View English Meanings of: muhayyakarnaywalataqseemkarnaywala

Definitions

English definition for distributer

1. n. electrical device that distributes voltage to the spark plugs of a gasoline engine in the order of the firing sequence

2. n. someone who markets merchandise

Sponored Video